Lineage for d2p23b1 (2p23 B:1041-1175)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 669060Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 669061Superfamily b.42.1: Cytokine [50353] (2 families) (S)
  5. 669062Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (8 proteins)
  6. 669190Protein Fibroblast growth factor-19 (FGF19) [101778] (1 species)
  7. 669191Species Human (Homo sapiens) [TaxId:9606] [101779] (2 PDB entries)
  8. 669194Domain d2p23b1: 2p23 B:1041-1175 [139460]
    automatically matched to d1pwaa_

Details for d2p23b1

PDB Entry: 2p23 (more details), 1.8 Å

PDB Description: Crystal structure of human FGF19
PDB Compounds: (B:) Fibroblast growth factor 19

SCOP Domain Sequences for d2p23b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p23b1 b.42.1.1 (B:1041-1175) Fibroblast growth factor-19 (FGF19) {Human (Homo sapiens) [TaxId: 9606]}
pirlrhlytsgphglsscflriradgvvdcargqsahslleikavalrtvaikgvhsvry
lcmgadgkmqgllqyseedcafeeeirpdgynvyrsekhrlpvslssakqrqlyknrgfl
plshflpmlpmvpee

SCOP Domain Coordinates for d2p23b1:

Click to download the PDB-style file with coordinates for d2p23b1.
(The format of our PDB-style files is described here.)

Timeline for d2p23b1: