Lineage for d2p23a_ (2p23 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2401196Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2401197Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 2401634Family b.42.1.0: automated matches [191477] (1 protein)
    not a true family
  6. 2401635Protein automated matches [190764] (2 species)
    not a true protein
  7. 2401643Species Human (Homo sapiens) [TaxId:9606] [187978] (13 PDB entries)
  8. 2401647Domain d2p23a_: 2p23 A: [139459]
    automated match to d2p39a_

Details for d2p23a_

PDB Entry: 2p23 (more details), 1.8 Å

PDB Description: Crystal structure of human FGF19
PDB Compounds: (A:) Fibroblast growth factor 19

SCOPe Domain Sequences for d2p23a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p23a_ b.42.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpirlrhlytsgphglsscflriradgvvdcargqsahslleikavalrtvaikgvhsvr
ylcmgadgkmqgllqyseedcafeeeirpdgynvyrsekhrlpvslssakqrqlyknrgf
lplshflpmlpmvpee

SCOPe Domain Coordinates for d2p23a_:

Click to download the PDB-style file with coordinates for d2p23a_.
(The format of our PDB-style files is described here.)

Timeline for d2p23a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2p23b_