| Class b: All beta proteins [48724] (180 folds) |
| Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.1: Cytokine [50353] (3 families) ![]() |
| Family b.42.1.0: automated matches [191477] (1 protein) not a true family |
| Protein automated matches [190764] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187978] (13 PDB entries) |
| Domain d2p23a_: 2p23 A: [139459] automated match to d2p39a_ |
PDB Entry: 2p23 (more details), 1.8 Å
SCOPe Domain Sequences for d2p23a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p23a_ b.42.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpirlrhlytsgphglsscflriradgvvdcargqsahslleikavalrtvaikgvhsvr
ylcmgadgkmqgllqyseedcafeeeirpdgynvyrsekhrlpvslssakqrqlyknrgf
lplshflpmlpmvpee
Timeline for d2p23a_: