SCOP 1.73: Domain d2p1da1: 2p1d A:7-265

Lineage for d2p1da1 (2p1d A:7-265)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (52 families)

5. Family c.66.1.25: mRNA cap methylase [88785] (2 proteins)

6. Protein An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 [89741] (1 species)
   structurally and functionally similar to VP39

7. Species Flavivirus (Dengue virus type 2) [TaxId:12637] [89742] (3 PDB entries)

8. Domain d2p1da1: 2p1d A:7-265 [139456]
   automatically matched to d1l9ka_
   complexed with 5gp, sah, so4

Details for d2p1da1

PDB Entry: 2p1d, 2.9 Å

PDB Description: Crystal structure of dengue methyltransferase in complex with GTP and S-Adenosyl-L-homocysteine

PDB Compounds: (A:) type II methyltransferase

SCOP Domain Sequences for d2p1da1:

Sequence; same for both SEQRES and ATOM records:

>d2p1da1 c.66.1.25 (A:7-265) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Flavivirus (Dengue virus type 2) [TaxId: 12637]}
etlgekwksrlnalgksefqiykksgiqevdrtlakegikrgetdhhavsrgsaklrwfv
ernlvtpegkvvdlgcgrggwsyycgglknvrevkgltkggpgheepipmstygwnlvrl
qsgvdvffippercdtllcdigesspnptveagrtlrvlnlvenwlsnntqfcvkvlnpy
mssviekmealqrkhggalvrnplsrnsthemywvsnasgnivssvnmisrmlinrftmr
hkkatyepdvdlgsgtrni

Timeline for d2p1da1:

• d2p1da1 is new in SCOP 1.73
  
• d2p1da1 appears in SCOP 1.75
  
• d2p1da1 appears in the current release, SCOPe 2.08, called d2p1da_