Lineage for d2p0jb_ (2p0j B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2490159Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2490160Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) (S)
  5. 2490510Family c.52.1.21: Restriction endonuclease BstyI [102471] (1 protein)
    automatically mapped to Pfam PF09195
  6. 2490511Protein Restriction endonuclease BstyI [102472] (1 species)
    local sequence similarity to BglII
  7. 2490512Species Geobacillus stearothermophilus [TaxId:1422] [102473] (4 PDB entries)
  8. 2490515Domain d2p0jb_: 2p0j B: [139455]
    automated match to d1sdoa_
    protein/DNA complex

Details for d2p0jb_

PDB Entry: 2p0j (more details), 2.1 Å

PDB Description: structure of restriction endonuclease bstyi bound to non-cognate dna
PDB Compounds: (B:) BstYI

SCOPe Domain Sequences for d2p0jb_:

Sequence, based on SEQRES records: (download)

>d2p0jb_ c.52.1.21 (B:) Restriction endonuclease BstyI {Geobacillus stearothermophilus [TaxId: 1422]}
mrivevyshlngleyiqvhlphiweeiqeiivsidaeacrtkeskektkqgqilyspval
neafkekleakgwkesrtnyyvtadpkliretlslepeeqkkvieaagkealksynqtdf
vkdrvaievqfgkysfvaydlfvkhmafyvsdkidvgveilpmkelskemssgisyyege
lynvirqgrgvpavplvligiap

Sequence, based on observed residues (ATOM records): (download)

>d2p0jb_ c.52.1.21 (B:) Restriction endonuclease BstyI {Geobacillus stearothermophilus [TaxId: 1422]}
mrivevyshlngleyiqvhlphiweeiqeiivsidaeacrtkeskelyspvalneafkek
leakgwkesrtnyyvtadpkliretlslepeeqkkvieaagkealksynqtdfvkdrvai
evqfgkysfvaydlfvkhmafyvsdkidvgveilpmkelskemssgisyyegelynvirq
grgvpavplvligiap

SCOPe Domain Coordinates for d2p0jb_:

Click to download the PDB-style file with coordinates for d2p0jb_.
(The format of our PDB-style files is described here.)

Timeline for d2p0jb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2p0ja_