![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
![]() | Superfamily c.52.1: Restriction endonuclease-like [52980] (34 families) ![]() |
![]() | Family c.52.1.21: Restriction endonuclease BstyI [102471] (1 protein) automatically mapped to Pfam PF09195 |
![]() | Protein Restriction endonuclease BstyI [102472] (1 species) local sequence similarity to BglII |
![]() | Species Geobacillus stearothermophilus [TaxId:1422] [102473] (3 PDB entries) |
![]() | Domain d2p0ja_: 2p0j A: [139454] automated match to d1sdoa_ protein/DNA complex |
PDB Entry: 2p0j (more details), 2.1 Å
SCOPe Domain Sequences for d2p0ja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p0ja_ c.52.1.21 (A:) Restriction endonuclease BstyI {Geobacillus stearothermophilus [TaxId: 1422]} mrivevyshlngleyiqvhlphiweeiqeiivsidaeacrtkeskektkqgqilyspval neafkekleakgwkesrtnyyvtadpkliretlslepeeqkkvieaagkealksynqtdf vkdrvaievqfgkysfvaydlfvkhmafyvsdkidvgveilpmkelskemssgisyyege lynvirqgrgvpavplvligiap
Timeline for d2p0ja_: