Lineage for d2ozua1 (2ozu A:507-776)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533209Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2533210Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2533211Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2533329Protein Histone acetyltransferase MYST3 [143702] (1 species)
    ESA1 orthologue
  7. 2533330Species Human (Homo sapiens) [TaxId:9606] [143703] (2 PDB entries)
    Uniprot Q92794 507-776
    solution structure of the zinc-binding motif have been determined in isolation (PDB 1m36, (103600))
  8. 2533331Domain d2ozua1: 2ozu A:507-776 [139451]
    complexed with acm, aco, zn

Details for d2ozua1

PDB Entry: 2ozu (more details), 2.3 Å

PDB Description: Crystal structure of human MYST histone acetyltransferase 3 in complex with acetylcoenzyme A
PDB Compounds: (A:) Histone acetyltransferase MYST3

SCOPe Domain Sequences for d2ozua1:

Sequence, based on SEQRES records: (download)

>d2ozua1 d.108.1.1 (A:507-776) Histone acetyltransferase MYST3 {Human (Homo sapiens) [TaxId: 9606]}
rcpsviefgkyeihtwysspypqeysrlpklylcefclkymksrtilqqhmkkcgwfhpp
aneiyrknnisvfevdgnvstiycqnlcllaklfldhktlyydvepflfyvltqndvkgc
hlvgyfskekhcqqkynvscimilpqyqrkgygrflidfsyllskregqagspekplsdl
grlsymaywksvileclyhqndkqisikklskltgicpqditstlhhlrmldfrsdqfvi
irrekliqdhmaklqlnlrpvdvdpeclrw

Sequence, based on observed residues (ATOM records): (download)

>d2ozua1 d.108.1.1 (A:507-776) Histone acetyltransferase MYST3 {Human (Homo sapiens) [TaxId: 9606]}
rcpsviefgkyeihtwysspypqeysrlpklylcefclkymksrtilqqhmkkcgwfhpp
aneiyrknnisvfevdgnvstiycqnlcllaklfldhktlyydvepflfyvltqndvkgc
hlvgyfskekhcqqkynvscimilpqyqrkgygrflidfsyllskregqagspekplsdl
grlsymaywksvileclyhqsikklskltgicpqditstlhhlrmlirrekliqdhmakl
qlrpvdvdpeclrw

SCOPe Domain Coordinates for d2ozua1:

Click to download the PDB-style file with coordinates for d2ozua1.
(The format of our PDB-style files is described here.)

Timeline for d2ozua1: