SCOPe 2.01: Domain d2ozld1: 2ozl D:0-191

Lineage for d2ozld1 (2ozl D:0-191)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.7: Branched-chain alpha-keto acid dehydrogenase Pyr module [88741] (4 proteins)
   parent family to TK and PFOR
   heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module

6. Protein E1-beta subunit of pyruvate dehydrogenase, Pyr module [69472] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89653] (2 PDB entries)

8. Domain d2ozld1: 2ozl D:0-191 [139449]
   Other proteins in same PDB: d2ozla1, d2ozlb2, d2ozlc_, d2ozld2
   automatically matched to d1ni4b1
   complexed with k, mg, tpp

Details for d2ozld1

PDB Entry: 2ozl, 1.9 Å

PDB Description: human pyruvate dehydrogenase s264e variant

PDB Compounds: (D:) Pyruvate dehydrogenase E1 component subunit beta

SCOPe Domain Sequences for d2ozld1:

Sequence; same for both SEQRES and ATOM records:

>d2ozld1 c.36.1.7 (D:0-191) E1-beta subunit of pyruvate dehydrogenase, Pyr module {Human (Homo sapiens) [TaxId: 9606]}
slqvtvrdainqgmdeelerdekvfllgeevaqydgaykvsrglwkkygdkriidtpise
mgfagiavgaamaglrpicefmtfnfsmqaidqvinsaaktyymsgglqpvpivfrgpng
asagvaaqhsqcfaawyghcpglkvvspwnsedakgliksairdnnpvvvlenelmygvp
fefppeaqskdf

Timeline for d2ozld1:

• d2ozld1 first appeared in SCOP 1.73
  
• d2ozld1 appears in SCOP 1.75
  
• d2ozld1 appears in SCOPe 2.02
  
• d2ozld1 appears in the current release, SCOPe 2.08