Lineage for d2ozlb2 (2ozl B:192-329)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 834846Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 834847Superfamily c.48.1: TK C-terminal domain-like [52922] (3 families) (S)
  5. 834899Family c.48.1.2: Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain [52926] (4 proteins)
  6. 834939Protein E1-beta subunit of pyruvate dehydrogenase, C-domain [69521] (2 species)
  7. 834942Species Human (Homo sapiens) [TaxId:9606] [89713] (2 PDB entries)
  8. 834943Domain d2ozlb2: 2ozl B:192-329 [139448]
    Other proteins in same PDB: d2ozla1, d2ozlb1, d2ozlc1, d2ozld1
    automatically matched to d1ni4b2
    complexed with k, mg, tpp; mutant

Details for d2ozlb2

PDB Entry: 2ozl (more details), 1.9 Å

PDB Description: Human pyruvate dehydrogenase S264E variant
PDB Compounds: (B:) Pyruvate dehydrogenase E1 component subunit beta

SCOP Domain Sequences for d2ozlb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ozlb2 c.48.1.2 (B:192-329) E1-beta subunit of pyruvate dehydrogenase, C-domain {Human (Homo sapiens) [TaxId: 9606]}
lipigkakierqgthitvvshsrpvghcleaaavlskegvecevinmrtirpmdmetiea
svmktnhlvtveggwpqfgvgaeicarimegpafnfldapavrvtgadvpmpyakiledn
sipqvkdiifaikktlni

SCOP Domain Coordinates for d2ozlb2:

Click to download the PDB-style file with coordinates for d2ozlb2.
(The format of our PDB-style files is described here.)

Timeline for d2ozlb2: