SCOP 1.75: Domain d2ozlb2: 2ozl B:192-329

Lineage for d2ozlb2 (2ozl B:192-329)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest

4. Superfamily c.48.1: TK C-terminal domain-like [52922] (3 families)

5. Family c.48.1.2: Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain [52926] (4 proteins)

6. Protein E1-beta subunit of pyruvate dehydrogenase, C-domain [69521] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89713] (2 PDB entries)

8. Domain d2ozlb2: 2ozl B:192-329 [139448]
   Other proteins in same PDB: d2ozla1, d2ozlb1, d2ozlc1, d2ozld1
   automatically matched to d1ni4b2
   complexed with k, mg, tpp; mutant

Details for d2ozlb2

PDB Entry: 2ozl, 1.9 Å

PDB Description: human pyruvate dehydrogenase s264e variant

PDB Compounds: (B:) Pyruvate dehydrogenase E1 component subunit beta

SCOP Domain Sequences for d2ozlb2:

Sequence; same for both SEQRES and ATOM records:

>d2ozlb2 c.48.1.2 (B:192-329) E1-beta subunit of pyruvate dehydrogenase, C-domain {Human (Homo sapiens) [TaxId: 9606]}
lipigkakierqgthitvvshsrpvghcleaaavlskegvecevinmrtirpmdmetiea
svmktnhlvtveggwpqfgvgaeicarimegpafnfldapavrvtgadvpmpyakiledn
sipqvkdiifaikktlni

Timeline for d2ozlb2:

• d2ozlb2 first appeared in SCOP 1.73
  
• d2ozlb2 appears in SCOPe 2.01
  
• d2ozlb2 appears in the current release, SCOPe 2.08