![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.48: TK C-terminal domain-like [52921] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest |
![]() | Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) ![]() |
![]() | Family c.48.1.2: Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain [52926] (5 proteins) automatically mapped to Pfam PF02780 |
![]() | Protein E1-beta subunit of pyruvate dehydrogenase, C-domain [69521] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [89713] (9 PDB entries) |
![]() | Domain d2ozlb2: 2ozl B:192-329 [139448] Other proteins in same PDB: d2ozla1, d2ozla2, d2ozlb1, d2ozlb3, d2ozlc2, d2ozlc3, d2ozld1, d2ozld3 automated match to d1ni4b2 complexed with k, mg, tpp |
PDB Entry: 2ozl (more details), 1.9 Å
SCOPe Domain Sequences for d2ozlb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ozlb2 c.48.1.2 (B:192-329) E1-beta subunit of pyruvate dehydrogenase, C-domain {Human (Homo sapiens) [TaxId: 9606]} lipigkakierqgthitvvshsrpvghcleaaavlskegvecevinmrtirpmdmetiea svmktnhlvtveggwpqfgvgaeicarimegpafnfldapavrvtgadvpmpyakiledn sipqvkdiifaikktlni
Timeline for d2ozlb2: