Lineage for d2ozlb2 (2ozl B:192-329)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2880614Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 2880615Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) (S)
  5. 2880667Family c.48.1.2: Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain [52926] (5 proteins)
    automatically mapped to Pfam PF02780
  6. 2880705Protein E1-beta subunit of pyruvate dehydrogenase, C-domain [69521] (2 species)
  7. 2880706Species Human (Homo sapiens) [TaxId:9606] [89713] (9 PDB entries)
  8. 2880707Domain d2ozlb2: 2ozl B:192-329 [139448]
    Other proteins in same PDB: d2ozla1, d2ozla2, d2ozlb1, d2ozlb3, d2ozlc2, d2ozlc3, d2ozld1, d2ozld3
    automated match to d1ni4b2
    complexed with k, mg, tpp

Details for d2ozlb2

PDB Entry: 2ozl (more details), 1.9 Å

PDB Description: human pyruvate dehydrogenase s264e variant
PDB Compounds: (B:) Pyruvate dehydrogenase E1 component subunit beta

SCOPe Domain Sequences for d2ozlb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ozlb2 c.48.1.2 (B:192-329) E1-beta subunit of pyruvate dehydrogenase, C-domain {Human (Homo sapiens) [TaxId: 9606]}
lipigkakierqgthitvvshsrpvghcleaaavlskegvecevinmrtirpmdmetiea
svmktnhlvtveggwpqfgvgaeicarimegpafnfldapavrvtgadvpmpyakiledn
sipqvkdiifaikktlni

SCOPe Domain Coordinates for d2ozlb2:

Click to download the PDB-style file with coordinates for d2ozlb2.
(The format of our PDB-style files is described here.)

Timeline for d2ozlb2: