SCOPe 2.06: Domain d2ozlb1: 2ozl B:2-191

Lineage for d2ozlb1 (2ozl B:2-191)

Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)

there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

Family c.36.1.7: Branched-chain alpha-keto acid dehydrogenase Pyr module [88741] (5 proteins)
parent family to TK and PFOR
heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module
automatically mapped to Pfam PF02779

Protein E1-beta subunit of pyruvate dehydrogenase, Pyr module [69472] (2 species)
Species Human (Homo sapiens) [TaxId:9606] [89653] (4 PDB entries)
Domain d2ozlb1: 2ozl B:2-191 [139447]
Other proteins in same PDB: d2ozla1, d2ozla2, d2ozlb2, d2ozlb3, d2ozlc2, d2ozlc3, d2ozld2, d2ozld3
automated match to d1ni4b1
complexed with k, mg, tpp

Details for d2ozlb1

PDB Entry: 2ozl (more details), 1.9 Å

PDB Description: human pyruvate dehydrogenase s264e variant

PDB Compounds: (B:) Pyruvate dehydrogenase E1 component subunit beta

SCOPe Domain Sequences for d2ozlb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ozlb1 c.36.1.7 (B:2-191) E1-beta subunit of pyruvate dehydrogenase, Pyr module {Human (Homo sapiens) [TaxId: 9606]}
qvtvrdainqgmdeelerdekvfllgeevaqydgaykvsrglwkkygdkriidtpisemg
fagiavgaamaglrpicefmtfnfsmqaidqvinsaaktyymsgglqpvpivfrgpngas
agvaaqhsqcfaawyghcpglkvvspwnsedakgliksairdnnpvvvlenelmygvpfe
fppeaqskdf

SCOPe Domain Coordinates for d2ozlb1:

Click to download the PDB-style file with coordinates for d2ozlb1.
(The format of our PDB-style files is described here.)

Timeline for d2ozlb1: