Lineage for d2ozbd1 (2ozb D:4-128)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2525085Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2525848Superfamily d.79.3: L30e-like [55315] (4 families) (S)
  5. 2525849Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 protein domains)
  6. 2525950Protein Spliceosomal 15.5kd protein [55321] (1 species)
  7. 2525951Species Human (Homo sapiens) [TaxId:9606] [55322] (3 PDB entries)
  8. 2525955Domain d2ozbd1: 2ozb D:4-128 [139446]
    Other proteins in same PDB: d2ozbb1, d2ozbe_
    automatically matched to d1e7ka_
    protein/RNA complex; complexed with ca

Details for d2ozbd1

PDB Entry: 2ozb (more details), 2.6 Å

PDB Description: structure of a human prp31-15.5k-u4 snrna complex
PDB Compounds: (D:) U4/U6.U5 tri-snRNP 15.5 kDa protein

SCOPe Domain Sequences for d2ozbd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ozbd1 d.79.3.1 (D:4-128) Spliceosomal 15.5kd protein {Human (Homo sapiens) [TaxId: 9606]}
advnpkaypladahltkklldlvqqscnykqlrkganeatktlnrgisefivmaadaepl
eiilhlpllcedknvpyvfvrskqalgracgvsrpviacsvtikegsqlkqqiqsiqqsi
erllv

SCOPe Domain Coordinates for d2ozbd1:

Click to download the PDB-style file with coordinates for d2ozbd1.
(The format of our PDB-style files is described here.)

Timeline for d2ozbd1: