Lineage for d2ozaa_ (2oza A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2218179Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2219935Protein MAP kinase activated protein kinase 2, mapkap2 [82789] (1 species)
    CaMK group; MAPKAPK subfamily; serine/threonine kinase
  7. 2219936Species Human (Homo sapiens) [TaxId:9606] [82790] (15 PDB entries)
  8. 2219940Domain d2ozaa_: 2oza A: [139443]
    Other proteins in same PDB: d2ozab_
    automated match to d1kwpa_

Details for d2ozaa_

PDB Entry: 2oza (more details), 2.7 Å

PDB Description: Structure of p38alpha complex
PDB Compounds: (A:) MAP kinase-activated protein kinase 2

SCOPe Domain Sequences for d2ozaa_:

Sequence, based on SEQRES records: (download)

>d2ozaa_ d.144.1.7 (A:) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]}
glqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarrevelhwr
asqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqaftereaseimksi
geaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettshnslttpcytpyyv
apevlgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrirmgqyefpnpe
wsevseevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsrvlkedkerwe
dvkeemtsalatmrvdyeqikikkiedasnplllkrrkka

Sequence, based on observed residues (ATOM records): (download)

>d2ozaa_ d.144.1.7 (A:) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]}
glqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarrevelhwr
asqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqaftereaseimksi
geaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettshnslttpcytpyyv
apevlgpekydkscdmwslgvimyillcgyppfysnhglrirmgqyefpnpewsevseev
kmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsrvlkedkerwedvkeemts
alatmrvdyeqikikkiedasnplllkrrkka

SCOPe Domain Coordinates for d2ozaa_:

Click to download the PDB-style file with coordinates for d2ozaa_.
(The format of our PDB-style files is described here.)

Timeline for d2ozaa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ozab_