SCOP 1.73: Domain d2oysb1: 2oys B:2-231

Lineage for d2oysb1 (2oys B:2-231)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (8 families)

5. Family c.23.5.5: Hypothetical protein SP1951 [102234] (1 protein)

6. Protein Hypothetical protein SP1951 [102235] (1 species)

7. Species (Streptococcus pneumoniae) [TaxId:1313] [102236] (2 PDB entries)

8. Domain d2oysb1: 2oys B:2-231 [139438]
   automatically matched to d1sqsa_
   complexed with edo, fmn

Details for d2oysb1

PDB Entry: 2oys, 2 Å

PDB Description: Crystal Structure of SP1951 protein from Streptococcus pneumoniae in complex with FMN, Northeast Structural Genomics Target SpR27

PDB Compounds: (B:) Hypothetical protein SP1951

SCOP Domain Sequences for d2oysb1:

Sequence; same for both SEQRES and ATOM records:

>d2oysb1 c.23.5.5 (B:2-231) Hypothetical protein SP1951 {(Streptococcus pneumoniae) [TaxId: 1313]}
nkifiyagvrnhnsktleytkrlssiissrnnvdisfrtpfnseleisnsdseelfkkgi
drqsnaddggvikkellesdiiiisspvylqnvsvdtknfieriggwshlfrlagkfvvt
ldvaesngsdnvseylrdifsymggqilhqvsitnslkdiaeaqlmeatykiedvlegki
kykttdyqerayqtlklilenydsehfekmywekkrlfeansleewyyve

Timeline for d2oysb1:

• d2oysb1 is new in SCOP 1.73
  
• d2oysb1 appears in SCOP 1.75
  
• d2oysb1 appears in the current release, SCOPe 2.08, called d2oysb_