SCOPe 2.08: Domain d2oysb_: 2oys B:

Lineage for d2oysb_ (2oys B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.5: Hypothetical protein SP1951 [102234] (2 proteins)

6. Protein automated matches [190342] (1 species)
   not a true protein

7. Species Streptococcus pneumoniae [TaxId:170187] [187168] (1 PDB entry)

8. Domain d2oysb_: 2oys B: [139438]
   automated match to d1sqsa_
   complexed with edo, fmn

Details for d2oysb_

PDB Entry: 2oys, 2 Å

PDB Description: Crystal Structure of SP1951 protein from Streptococcus pneumoniae in complex with FMN, Northeast Structural Genomics Target SpR27

PDB Compounds: (B:) Hypothetical protein SP1951

SCOPe Domain Sequences for d2oysb_:

Sequence; same for both SEQRES and ATOM records:

>d2oysb_ c.23.5.5 (B:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
nkifiyagvrnhnsktleytkrlssiissrnnvdisfrtpfnseleisnsdseelfkkgi
drqsnaddggvikkellesdiiiisspvylqnvsvdtknfieriggwshlfrlagkfvvt
ldvaesngsdnvseylrdifsymggqilhqvsitnslkdiaeaqlmeatykiedvlegki
kykttdyqerayqtlklilenydsehfekmywekkrlfeansleewyyve

Timeline for d2oysb_:

• d2oysb_ first appeared in SCOP 1.73, called d2oysb1
  
• d2oysb_ appears in SCOPe 2.07