Lineage for d2oysa_ (2oys A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2115525Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2115973Family c.23.5.5: Hypothetical protein SP1951 [102234] (2 proteins)
  6. 2115978Protein automated matches [190342] (1 species)
    not a true protein
  7. 2115979Species Streptococcus pneumoniae [TaxId:170187] [187168] (1 PDB entry)
  8. 2115980Domain d2oysa_: 2oys A: [139437]
    automated match to d1sqsa_
    complexed with edo, fmn

Details for d2oysa_

PDB Entry: 2oys (more details), 2 Å

PDB Description: Crystal Structure of SP1951 protein from Streptococcus pneumoniae in complex with FMN, Northeast Structural Genomics Target SpR27
PDB Compounds: (A:) Hypothetical protein SP1951

SCOPe Domain Sequences for d2oysa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oysa_ c.23.5.5 (A:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
nkifiyagvrnhnsktleytkrlssiissrnnvdisfrtpfnseleisnsdseelfkkgi
drqsnaddggvikkellesdiiiisspvylqnvsvdtknfieriggwshlfrlagkfvvt
ldvaesngsdnvseylrdifsymggqilhqvsitnslkdiaeaqlmeatykiedvlegki
kykttdyqerayqtlklilenydsehfekmywekkrlfeansleewyyve

SCOPe Domain Coordinates for d2oysa_:

Click to download the PDB-style file with coordinates for d2oysa_.
(The format of our PDB-style files is described here.)

Timeline for d2oysa_: