| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) ![]() |
| Family c.23.5.5: Hypothetical protein SP1951 [102234] (2 proteins) |
| Protein automated matches [190342] (1 species) not a true protein |
| Species Streptococcus pneumoniae [TaxId:170187] [187168] (1 PDB entry) |
| Domain d2oysa_: 2oys A: [139437] automated match to d1sqsa_ complexed with edo, fmn |
PDB Entry: 2oys (more details), 2 Å
SCOPe Domain Sequences for d2oysa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oysa_ c.23.5.5 (A:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
nkifiyagvrnhnsktleytkrlssiissrnnvdisfrtpfnseleisnsdseelfkkgi
drqsnaddggvikkellesdiiiisspvylqnvsvdtknfieriggwshlfrlagkfvvt
ldvaesngsdnvseylrdifsymggqilhqvsitnslkdiaeaqlmeatykiedvlegki
kykttdyqerayqtlklilenydsehfekmywekkrlfeansleewyyve
Timeline for d2oysa_: