SCOP 1.73: Domain d2oyia1: 2oyi A:126-190

Lineage for d2oyia1 (2oyi A:126-190)

1. Root: SCOP 1.73

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (33 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family)

5. Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
   in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails

6. Protein Fibrinogen alpha chain [88887] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88889] (21 PDB entries)

8. Domain d2oyia1: 2oyi A:126-190 [139435]
   automatically matched to 2FFD A:126-190

Details for d2oyia1

PDB Entry: 2oyi, 2.7 Å

PDB Description: crystal structure of fragment d of gammad298,301a fibrinogen with the peptide ligand gly-pro-arg-pro-amide

PDB Compounds: (A:) fibrinogen alpha chain

SCOP Domain Sequences for d2oyia1:

Sequence; same for both SEQRES and ATOM records:

>d2oyia1 h.1.8.1 (A:126-190) Fibrinogen alpha chain {Human (Homo sapiens) [TaxId: 9606]}
viekvqhiqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdyedqqkql
eqvia

Timeline for d2oyia1:

• d2oyia1 is new in SCOP 1.73
  
• d2oyia1 appears in SCOP 1.75
  
• d2oyia1 appears in the current release, SCOPe 2.08