Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (2 families) |
Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins) in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails |
Protein Fibrinogen alpha chain [88887] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [88889] (22 PDB entries) Uniprot P02671 150-209 |
Domain d2oyia1: 2oyi A:126-190 [139435] Other proteins in same PDB: d2oyic1, d2oyic2 automatically matched to 2FFD A:126-190 complexed with ca |
PDB Entry: 2oyi (more details), 2.7 Å
SCOPe Domain Sequences for d2oyia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oyia1 h.1.8.1 (A:126-190) Fibrinogen alpha chain {Human (Homo sapiens) [TaxId: 9606]} viekvqhiqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdyedqqkql eqvia
Timeline for d2oyia1: