Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (34 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family) |
Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins) in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails |
Protein Fibrinogen alpha chain [88887] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [88889] (22 PDB entries) Uniprot P02671 150-209 |
Domain d2oyhd1: 2oyh D:133-186 [139434] Other proteins in same PDB: d2oyhc1, d2oyhc2 automatically matched to 2FFD A:126-190 complexed with ca, fuc, nag; mutant |
PDB Entry: 2oyh (more details), 2.4 Å
SCOP Domain Sequences for d2oyhd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oyhd1 h.1.8.1 (D:133-186) Fibrinogen alpha chain {Human (Homo sapiens) [TaxId: 9606]} iqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdyedqqkqle
Timeline for d2oyhd1: