Lineage for d2oyfa_ (2oyf A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1750246Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 1750247Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 1750252Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 1750608Protein automated matches [190139] (25 species)
    not a true protein
  7. 1750661Species Daboia russellii [TaxId:97228] [186865] (27 PDB entries)
  8. 1750664Domain d2oyfa_: 2oyf A: [139432]
    automated match to d1tgma_
    complexed with acy, iac, so4

Details for d2oyfa_

PDB Entry: 2oyf (more details), 1.2 Å

PDB Description: Crystal Structure of the complex of phospholipase A2 with indole acetic acid at 1.2 A resolution
PDB Compounds: (A:) Phospholipase A2 VRV-PL-VIIIa

SCOPe Domain Sequences for d2oyfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oyfa_ a.133.1.2 (A:) automated matches {Daboia russellii [TaxId: 97228]}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

SCOPe Domain Coordinates for d2oyfa_:

Click to download the PDB-style file with coordinates for d2oyfa_.
(The format of our PDB-style files is described here.)

Timeline for d2oyfa_: