Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) |
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins) |
Protein Neutrophil collagenase (MMP-8) [55532] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [55533] (24 PDB entries) |
Domain d2oy4a_: 2oy4 A: [139430] automated match to d1a85a_ complexed with ca, zn |
PDB Entry: 2oy4 (more details), 1.7 Å
SCOPe Domain Sequences for d2oy4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oy4a_ d.92.1.11 (A:) Neutrophil collagenase (MMP-8) {Human (Homo sapiens) [TaxId: 9606]} pkwertnltyrirnytpqlseaeveraikdafelwsvaspliftrisqgeadiniafyqr dhgdnspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahefghslgl ahssdpgalmypnyafretsnyslpqddidgiqaiyg
Timeline for d2oy4a_: