SCOP 1.73: Domain d2oy2f1: 2oy2 F:86-242

Lineage for d2oy2f1 (2oy2 F:86-242)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (13 proteins)

6. Protein Neutrophil collagenase (MMP-8) [55532] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55533] (19 PDB entries)

8. Domain d2oy2f1: 2oy2 F:86-242 [139429]
   automatically matched to d1bzsa_
   complexed with ca, zn

Details for d2oy2f1

PDB Entry: 2oy2, 1.5 Å

PDB Description: human mmp-8 in complex with peptide iag

PDB Compounds: (F:) Neutrophil collagenase

SCOP Domain Sequences for d2oy2f1:

Sequence; same for both SEQRES and ATOM records:

>d2oy2f1 d.92.1.11 (F:86-242) Neutrophil collagenase (MMP-8) {Human (Homo sapiens) [TaxId: 9606]}
pkwertnltyrirnytpqlseaeveraikdafelwsvaspliftrisqgeadiniafyqr
dhgdnspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahefghslgl
ahssdpgalmypnyafretsnyslpqddidgiqaiyg

Timeline for d2oy2f1:

• d2oy2f1 is new in SCOP 1.73
  
• d2oy2f1 appears in SCOP 1.75
  
• d2oy2f1 appears in the current release, SCOPe 2.08, called d2oy2f_