Lineage for d2oy2a_ (2oy2 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964231Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2964527Protein Neutrophil collagenase (MMP-8) [55532] (1 species)
  7. 2964528Species Human (Homo sapiens) [TaxId:9606] [55533] (24 PDB entries)
  8. 2964539Domain d2oy2a_: 2oy2 A: [139428]
    automated match to d1a85a_
    complexed with ca, zn

Details for d2oy2a_

PDB Entry: 2oy2 (more details), 1.5 Å

PDB Description: human mmp-8 in complex with peptide iag
PDB Compounds: (A:) Neutrophil collagenase

SCOPe Domain Sequences for d2oy2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oy2a_ d.92.1.11 (A:) Neutrophil collagenase (MMP-8) {Human (Homo sapiens) [TaxId: 9606]}
pkwertnltyrirnytpqlseaeveraikdafelwsvaspliftrisqgeadiniafyqr
dhgdnspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahefghslgl
ahssdpgalmypnyafretsnyslpqddidgiqaiyg

SCOPe Domain Coordinates for d2oy2a_:

Click to download the PDB-style file with coordinates for d2oy2a_.
(The format of our PDB-style files is described here.)

Timeline for d2oy2a_: