SCOPe 2.06: Domain d2oxwa_: 2oxw A:

Lineage for d2oxwa_ (2oxw A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein Macrophage elastase (MMP-12) [69780] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69781] (39 PDB entries)
   Uniprot P39900 106-263 ! Uniprot P39900 106-264

8. Domain d2oxwa_: 2oxw A: [139426]
   automated match to d1os2a_
   complexed with ca, zn

Details for d2oxwa_

PDB Entry: 2oxw, 1.15 Å

PDB Description: human mmp-12 complexed with the peptide iag

PDB Compounds: (A:) Macrophage metalloelastase

SCOPe Domain Sequences for d2oxwa_:

Sequence; same for both SEQRES and ATOM records:

>d2oxwa_ d.92.1.11 (A:) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslyg

Timeline for d2oxwa_:

• d2oxwa_ first appeared in SCOP 1.73, called d2oxwa1
  
• d2oxwa_ appears in SCOPe 2.05
  
• d2oxwa_ appears in SCOPe 2.07
  
• d2oxwa_ appears in the current release, SCOPe 2.08