SCOP 1.73: Domain d2oxua1: 2oxu A:106-263

Lineage for d2oxua1 (2oxu A:106-263)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (13 proteins)

6. Protein Macrophage elastase (MMP-12) [69780] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69781] (15 PDB entries)

8. Domain d2oxua1: 2oxu A:106-263 [139425]
   automatically matched to d1os2a_
   complexed with ca, zn; mutant

Details for d2oxua1

PDB Entry: 2oxu, 1.24 Å

PDB Description: uninhibited form of human mmp-12

PDB Compounds: (A:) Macrophage metalloelastase

SCOP Domain Sequences for d2oxua1:

Sequence; same for both SEQRES and ATOM records:

>d2oxua1 d.92.1.11 (A:106-263) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslyg

Timeline for d2oxua1:

• d2oxua1 is new in SCOP 1.73
  
• d2oxua1 appears in SCOP 1.75
  
• d2oxua1 appears in the current release, SCOPe 2.08, called d2oxua_