SCOPe 2.01: Domain d2owja_: 2owj A:

Lineage for d2owja_ (2owj A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.2: Heme-binding PAS domain [55789] (3 proteins)

6. Protein Histidine kinase FixL heme domain [55790] (2 species)

7. Species Bradyrhizobium japonicum [TaxId:375] [55792] (18 PDB entries)
   Uniprot P23222 152-270

8. Domain d2owja_: 2owj A: [139422]
   automated match to d1dp6a_
   complexed with cmo, hem

Details for d2owja_

PDB Entry: 2owj, 2.5 Å

PDB Description: Structure of an early-microsecond photolyzed state of CO-bjFixLH, dark state

PDB Compounds: (A:) sensor protein fixl

SCOPe Domain Sequences for d2owja_:

Sequence; same for both SEQRES and ATOM records:

>d2owja_ d.110.3.2 (A:) Histidine kinase FixL heme domain {Bradyrhizobium japonicum [TaxId: 375]}
damividghgiiqlfstaaerlfgwseleaigqnvnilmpepdrsrhdsyisryrttsdp
hiigigrivtgkrrdgttfpmhlsigemqsggepyftgfvrdltehqqtqarlqel

Timeline for d2owja_:

• d2owja_ first appeared in SCOP 1.73, called d2owja1
  
• d2owja_ was called d2owja1 in SCOP 1.75
  
• d2owja_ appears in SCOPe 2.02
  
• d2owja_ appears in the current release, SCOPe 2.08