Lineage for d2ow8t1 (2ow8 t:2-81)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1408957Fold d.28: Ribosomal protein S19 [54569] (1 superfamily)
    alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123
  4. 1408958Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) (S)
    automatically mapped to Pfam PF00203
  5. 1408959Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein)
  6. 1408960Protein Ribosomal protein S19 [54572] (2 species)
  7. 1408988Species Thermus thermophilus [TaxId:274] [54573] (38 PDB entries)
    Uniprot P80381
  8. 1409022Domain d2ow8t1: 2ow8 t:2-81 [139417]
    Other proteins in same PDB: d2ow8c1, d2ow8d1, d2ow8d2, d2ow8e1, d2ow8f1, d2ow8f2, d2ow8g1, d2ow8h1, d2ow8i1, d2ow8j1, d2ow8k1, d2ow8l1, d2ow8m1, d2ow8n1, d2ow8o1, d2ow8p1, d2ow8q1, d2ow8r1, d2ow8s1, d2ow8u1, d2ow8v1
    automatically matched to d1fjgs_
    protein/RNA complex

Details for d2ow8t1

PDB Entry: 2ow8 (more details), 3.71 Å

PDB Description: Crystal Structure of a 70S Ribosome-tRNA Complex Reveals Functional Interactions and Rearrangements. This file, 2OW8, contains the 30S ribosome subunit, two tRNA, and mRNA molecules. 50S ribosome subunit is in the file 1VSA.
PDB Compounds: (t:) 30S ribosomal protein S19

SCOPe Domain Sequences for d2ow8t1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ow8t1 d.28.1.1 (t:2-81) Ribosomal protein S19 {Thermus thermophilus [TaxId: 274]}
prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
itenmvghklgefaptrtyr

SCOPe Domain Coordinates for d2ow8t1:

Click to download the PDB-style file with coordinates for d2ow8t1.
(The format of our PDB-style files is described here.)

Timeline for d2ow8t1: