Lineage for d2ow8s1 (2ow8 s:19-88)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1723549Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) (S)
  5. 1723550Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)
  6. 1723551Protein Ribosomal protein S18 [46913] (2 species)
  7. 1723577Species Thermus thermophilus [TaxId:274] [46914] (47 PDB entries)
    Uniprot P80382
  8. 1723618Domain d2ow8s1: 2ow8 s:19-88 [139416]
    Other proteins in same PDB: d2ow8c1, d2ow8d1, d2ow8d2, d2ow8e1, d2ow8f1, d2ow8f2, d2ow8g1, d2ow8h1, d2ow8i1, d2ow8j1, d2ow8k1, d2ow8l1, d2ow8m1, d2ow8n1, d2ow8o1, d2ow8p1, d2ow8q1, d2ow8r1, d2ow8t1, d2ow8u1, d2ow8v1
    protein/RNA complex
    protein/RNA complex

Details for d2ow8s1

PDB Entry: 2ow8 (more details), 3.71 Å

PDB Description: Crystal Structure of a 70S Ribosome-tRNA Complex Reveals Functional Interactions and Rearrangements. This file, 2OW8, contains the 30S ribosome subunit, two tRNA, and mRNA molecules. 50S ribosome subunit is in the file 1VSA.
PDB Compounds: (s:) 30S ribosomal protein S18

SCOPe Domain Sequences for d2ow8s1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ow8s1 a.4.8.1 (s:19-88) Ribosomal protein S18 {Thermus thermophilus [TaxId: 274]}
kakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsakeqrilaktikrarilgl
lpfteklvrk

SCOPe Domain Coordinates for d2ow8s1:

Click to download the PDB-style file with coordinates for d2ow8s1.
(The format of our PDB-style files is described here.)

Timeline for d2ow8s1: