Lineage for d2ow8o1 (2ow8 o:2-61)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1705142Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 1705143Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 1705456Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)
  6. 1705457Protein Ribosomal protein S14 [57753] (2 species)
  7. 1705483Species Thermus thermophilus [TaxId:274] [57754] (45 PDB entries)
    Uniprot P24320
  8. 1705524Domain d2ow8o1: 2ow8 o:2-61 [139412]
    Other proteins in same PDB: d2ow8c1, d2ow8d1, d2ow8d2, d2ow8e1, d2ow8f1, d2ow8f2, d2ow8g1, d2ow8h1, d2ow8i1, d2ow8j1, d2ow8k1, d2ow8l1, d2ow8m1, d2ow8n1, d2ow8p1, d2ow8q1, d2ow8r1, d2ow8s1, d2ow8t1, d2ow8u1, d2ow8v1
    automatically matched to d1fjgn_
    protein/RNA complex

Details for d2ow8o1

PDB Entry: 2ow8 (more details), 3.71 Å

PDB Description: Crystal Structure of a 70S Ribosome-tRNA Complex Reveals Functional Interactions and Rearrangements. This file, 2OW8, contains the 30S ribosome subunit, two tRNA, and mRNA molecules. 50S ribosome subunit is in the file 1VSA.
PDB Compounds: (o:) 30S ribosomal protein S14

SCOPe Domain Sequences for d2ow8o1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ow8o1 g.39.1.7 (o:2-61) Ribosomal protein S14 {Thermus thermophilus [TaxId: 274]}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

SCOPe Domain Coordinates for d2ow8o1:

Click to download the PDB-style file with coordinates for d2ow8o1.
(The format of our PDB-style files is described here.)

Timeline for d2ow8o1: