SCOP 1.73: Domain d2ow8o1: 2ow8 o:2-61

Lineage for d2ow8o1 (2ow8 o:2-61)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (15 families)

5. Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)

6. Protein Ribosomal protein S14 [57753] (1 species)

7. Species Thermus thermophilus [TaxId:274] [57754] (36 PDB entries)

8. Domain d2ow8o1: 2ow8 o:2-61 [139412]
   Other proteins in same PDB: d2ow8c1, d2ow8d1, d2ow8d2, d2ow8e1, d2ow8f1, d2ow8f2, d2ow8g1, d2ow8h1, d2ow8i1, d2ow8j1, d2ow8k1, d2ow8l1, d2ow8m1, d2ow8n1, d2ow8p1, d2ow8q1, d2ow8r1, d2ow8s1, d2ow8t1, d2ow8u1
   automatically matched to d1fjgn_
   complexed with 2mg, 4oc, 4su, 5mc, 5mu, 7mg, h2u, m2g, ma6, mia, psu, ur3

Details for d2ow8o1

PDB Entry: 2ow8, 3.71 Å

PDB Description: Crystal Structure of a 70S Ribosome-tRNA Complex Reveals Functional Interactions and Rearrangements. This file, 2OW8, contains the 30S ribosome subunit, two tRNA, and mRNA molecules. 50S ribosome subunit is in the file 1VSA.

PDB Compounds: (o:) 30S ribosomal protein S14

SCOP Domain Sequences for d2ow8o1:

Sequence; same for both SEQRES and ATOM records:

>d2ow8o1 g.39.1.7 (o:2-61) Ribosomal protein S14 {Thermus thermophilus [TaxId: 274]}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

Timeline for d2ow8o1:

• d2ow8o1 is new in SCOP 1.73
  
• d2ow8o1 appears in SCOP 1.75
  
• d2ow8o1 appears in the current release, SCOPe 2.08