Lineage for d2ow8l1 (2ow8 l:11-126)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 701284Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 702503Superfamily c.55.4: Translational machinery components [53137] (2 families) (S)
  5. 702504Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)
  6. 702551Protein Ribosomal protein S11 [53141] (1 species)
  7. 702552Species Thermus thermophilus [TaxId:274] [53142] (37 PDB entries)
  8. 702584Domain d2ow8l1: 2ow8 l:11-126 [139409]
    Other proteins in same PDB: d2ow8c1, d2ow8d1, d2ow8d2, d2ow8e1, d2ow8f1, d2ow8f2, d2ow8g1, d2ow8h1, d2ow8i1, d2ow8j1, d2ow8k1, d2ow8m1, d2ow8n1, d2ow8o1, d2ow8p1, d2ow8q1, d2ow8r1, d2ow8s1, d2ow8t1, d2ow8u1
    automatically matched to d1i94k_
    complexed with 2mg, 4oc, 4su, 5mc, 5mu, 7mg, h2u, m2g, ma6, mia, psu, ur3

Details for d2ow8l1

PDB Entry: 2ow8 (more details), 3.71 Å

PDB Description: Crystal Structure of a 70S Ribosome-tRNA Complex Reveals Functional Interactions and Rearrangements. This file, 2OW8, contains the 30S ribosome subunit, two tRNA, and mRNA molecules. 50S ribosome subunit is in the file 1VSA.
PDB Compounds: (l:) 30S ribosomal protein S11

SCOP Domain Sequences for d2ow8l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ow8l1 c.55.4.1 (l:11-126) Ribosomal protein S11 {Thermus thermophilus [TaxId: 274]}
krqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaaldaak
kamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkfr

SCOP Domain Coordinates for d2ow8l1:

Click to download the PDB-style file with coordinates for d2ow8l1.
(The format of our PDB-style files is described here.)

Timeline for d2ow8l1: