![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family) ![]() fold elaborated with additional structures |
![]() | Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein) |
![]() | Protein Ribosomal protein S2 [52315] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [52316] (46 PDB entries) Uniprot P80371 |
![]() | Domain d2ow8c1: 2ow8 c:7-240 [139398] Other proteins in same PDB: d2ow8d1, d2ow8d2, d2ow8e1, d2ow8f1, d2ow8f2, d2ow8g1, d2ow8h1, d2ow8i1, d2ow8j1, d2ow8k1, d2ow8l1, d2ow8m1, d2ow8n1, d2ow8o1, d2ow8p1, d2ow8q1, d2ow8r1, d2ow8s1, d2ow8t1, d2ow8u1, d2ow8v1 automatically matched to d1i94b_ protein/RNA complex |
PDB Entry: 2ow8 (more details), 3.71 Å
SCOPe Domain Sequences for d2ow8c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ow8c1 c.23.15.1 (c:7-240) Ribosomal protein S2 {Thermus thermophilus [TaxId: 274]} vkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedlamrgg tilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleelealfaspe ieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklfipvia ladtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvq
Timeline for d2ow8c1: