![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) ![]() |
![]() | Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins) |
![]() | Protein Gelatinase B (MMP-9) [75496] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [75497] (18 PDB entries) |
![]() | Domain d2ow1b_: 2ow1 B: [139395] automated match to d1gkda_ complexed with 7mr, ca, cl, zn; mutant |
PDB Entry: 2ow1 (more details), 2.2 Å
SCOPe Domain Sequences for d2ow1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ow1b_ d.92.1.11 (B:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} lkwhhhnitywiqnysedlpraviddafarafalwsavtpltftrvysrdadiviqfgva ehgdgypfdgkdgllahafppgpgiqgdahfdddelwslgkgqgyslflvaahqfghalg ldhssvpealmypmyrftegpplhkddvngirhly
Timeline for d2ow1b_: