![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) ![]() |
![]() | Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (13 proteins) |
![]() | Protein Gelatinase B (MMP-9) [75496] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [75497] (8 PDB entries) |
![]() | Domain d2ow1b1: 2ow1 B:114-443 [139395] automatically matched to d1gkda_ complexed with 7mr, ca, cl, zn; mutant |
PDB Entry: 2ow1 (more details), 2.2 Å
SCOP Domain Sequences for d2ow1b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ow1b1 d.92.1.11 (B:114-443) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} lkwhhhnitywiqnysedlpraviddafarafalwsavtpltftrvysrdadiviqfgva ehgdgypfdgkdgllahafppgpgiqgdahfdddelwslgkgqgyslflvaahqfghalg ldhssvpealmypmyrftegpplhkddvngirhly
Timeline for d2ow1b1: