SCOPe 2.07: Domain d2ow1a_: 2ow1 A:

Lineage for d2ow1a_ (2ow1 A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein Gelatinase B (MMP-9) [75496] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75497] (18 PDB entries)

8. Domain d2ow1a_: 2ow1 A: [139394]
   automated match to d1gkda_
   complexed with 7mr, ca, cl, zn; mutant

Details for d2ow1a_

PDB Entry: 2ow1, 2.2 Å

PDB Description: mmp-9 active site mutant with trifluoromethyl hydroxamate inhibitor

PDB Compounds: (A:) Matrix metalloproteinase-9 (MMP-9) (92 kDa type IV collagenase) (92 kDa gelatinase) (Gelatinase B) (GELB)

SCOPe Domain Sequences for d2ow1a_:

Sequence; same for both SEQRES and ATOM records:

>d2ow1a_ d.92.1.11 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]}
fegdlkwhhhnitywiqnysedlpraviddafarafalwsavtpltftrvysrdadiviq
fgvaehgdgypfdgkdgllahafppgpgiqgdahfdddelwslgkgqgyslflvaahqfg
halgldhssvpealmypmyrftegpplhkddvngirhly

Timeline for d2ow1a_:

• d2ow1a_ first appeared in SCOP 1.73, called d2ow1a1
  
• d2ow1a_ appears in SCOPe 2.06
  
• d2ow1a_ appears in the current release, SCOPe 2.08