Lineage for d2ow0b_ (2ow0 B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2204982Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2204983Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2205557Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2205700Protein Gelatinase B (MMP-9) [75496] (1 species)
  7. 2205701Species Human (Homo sapiens) [TaxId:9606] [75497] (16 PDB entries)
  8. 2205713Domain d2ow0b_: 2ow0 B: [139393]
    automated match to d1gkda_
    complexed with 6mr, ca, cl, zn; mutant

Details for d2ow0b_

PDB Entry: 2ow0 (more details), 2 Å

PDB Description: mmp-9 active site mutant with iodine-labeled carboxylate inhibitor
PDB Compounds: (B:) Matrix metalloproteinase-9 (MMP-9) (92 kDa type IV collagenase) (92 kDa gelatinase) (Gelatinase B) (GELB)

SCOPe Domain Sequences for d2ow0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ow0b_ d.92.1.11 (B:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]}
lkwhhhnitywiqnysedlpraviddafarafalwsavtpltftrvysrdadiviqfgva
ehgdgypfdgkdgllahafppgpgiqgdahfdddelwslgkgqgyslflvaahqfghalg
ldhssvpealmypmyrftegpplhkddvngirhly

SCOPe Domain Coordinates for d2ow0b_:

Click to download the PDB-style file with coordinates for d2ow0b_.
(The format of our PDB-style files is described here.)

Timeline for d2ow0b_: