Lineage for d2ovzb_ (2ovz B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2570195Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2570196Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2570846Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2570990Protein Gelatinase B (MMP-9) [75496] (1 species)
  7. 2570991Species Human (Homo sapiens) [TaxId:9606] [75497] (18 PDB entries)
  8. 2571017Domain d2ovzb_: 2ovz B: [139391]
    automated match to d1gkda_
    complexed with 5mr, ca, cl, zn; mutant

Details for d2ovzb_

PDB Entry: 2ovz (more details), 2 Å

PDB Description: mmp-9 active site mutant with phosphinate inhibitor
PDB Compounds: (B:) Matrix metalloproteinase-9 (EC 3.4.24.35) (MMP-9) (92 kDa type IV collagenase) (92 kDa gelatinase) (Gelatinase B) (GELB)

SCOPe Domain Sequences for d2ovzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ovzb_ d.92.1.11 (B:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]}
lkwhhhnitywiqnysedlpraviddafarafalwsavtpltftrvysrdadiviqfgva
ehgdgypfdgkdgllahafppgpgiqgdahfdddelwslgkgqgyslflvaahqfghalg
ldhssvpealmypmyrftegpplhkddvngirhly

SCOPe Domain Coordinates for d2ovzb_:

Click to download the PDB-style file with coordinates for d2ovzb_.
(The format of our PDB-style files is described here.)

Timeline for d2ovzb_: