Lineage for d2ovzb1 (2ovz B:114-443)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 729090Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 729091Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) (S)
  5. 729341Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (13 proteins)
  6. 729404Protein Gelatinase B (MMP-9) [75496] (1 species)
  7. 729405Species Human (Homo sapiens) [TaxId:9606] [75497] (8 PDB entries)
  8. 729409Domain d2ovzb1: 2ovz B:114-443 [139391]
    automatically matched to d1gkda_
    complexed with 5mr, ca, cl, zn; mutant

Details for d2ovzb1

PDB Entry: 2ovz (more details), 2 Å

PDB Description: mmp-9 active site mutant with phosphinate inhibitor
PDB Compounds: (B:) Matrix metalloproteinase-9 (EC 3.4.24.35) (MMP-9) (92 kDa type IV collagenase) (92 kDa gelatinase) (Gelatinase B) (GELB)

SCOP Domain Sequences for d2ovzb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ovzb1 d.92.1.11 (B:114-443) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]}
lkwhhhnitywiqnysedlpraviddafarafalwsavtpltftrvysrdadiviqfgva
ehgdgypfdgkdgllahafppgpgiqgdahfdddelwslgkgqgyslflvaahqfghalg
ldhssvpealmypmyrftegpplhkddvngirhly

SCOP Domain Coordinates for d2ovzb1:

Click to download the PDB-style file with coordinates for d2ovzb1.
(The format of our PDB-style files is described here.)

Timeline for d2ovzb1: