Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) |
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins) |
Protein Gelatinase B (MMP-9) [75496] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [75497] (18 PDB entries) |
Domain d2ovxb_: 2ovx B: [139389] automated match to d1gkda_ complexed with 4mr, ca, cl, zn; mutant |
PDB Entry: 2ovx (more details), 2 Å
SCOPe Domain Sequences for d2ovxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ovxb_ d.92.1.11 (B:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} fegdlkwhhhnitywiqnysedlpraviddafarafalwsavtpltftrvysrdadiviq fgvaehgdgypfdgkdgllahafppgpgiqgdahfdddelwslgkgqgyslflvaahqfg halgldhssvpealmypmyrftegpplhkddvngirhly
Timeline for d2ovxb_: