SCOP 1.75: Domain d2ovxa1: 2ovx A:110-443

Lineage for d2ovxa1 (2ovx A:110-443)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (17 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (13 proteins)

6. Protein Gelatinase B (MMP-9) [75496] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75497] (8 PDB entries)

8. Domain d2ovxa1: 2ovx A:110-443 [139388]
   automatically matched to d1gkda_
   complexed with 4mr, ca, cl, zn; mutant

Details for d2ovxa1

PDB Entry: 2ovx, 2 Å

PDB Description: mmp-9 active site mutant with barbiturate inhibitor

PDB Compounds: (A:) Matrix metalloproteinase-9 (EC 3.4.24.35) (MMP-9) (92 kDa type IV collagenase) (92 kDa gelatinase) (Gelatinase B) (GELB)

SCOP Domain Sequences for d2ovxa1:

Sequence; same for both SEQRES and ATOM records:

>d2ovxa1 d.92.1.11 (A:110-443) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]}
fegdlkwhhhnitywiqnysedlpraviddafarafalwsavtpltftrvysrdadiviq
fgvaehgdgypfdgkdgllahafppgpgiqgdahfdddelwslgkgqgyslflvaahqfg
halgldhssvpealmypmyrftegpplhkddvngirhly

Timeline for d2ovxa1:

• d2ovxa1 first appeared in SCOP 1.73
  
• d2ovxa1 is called d2ovxa_ in SCOPe 2.01
  
• d2ovxa1 appears in the current release, SCOPe 2.08, called d2ovxa_