Lineage for d2ovra2 (2ovr A:1002-1065)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2513276Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2513277Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2513278Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)
  6. 2513335Protein Cyclin A/CDK2-associated p45, Skp1 [54710] (1 species)
  7. 2513336Species Human (Homo sapiens) [TaxId:9606] [54711] (9 PDB entries)
  8. 2513339Domain d2ovra2: 2ovr A:1002-1065 [139387]
    Other proteins in same PDB: d2ovra1, d2ovrb1, d2ovrb2
    automatically matched to d1fqvb2
    complexed with so4

Details for d2ovra2

PDB Entry: 2ovr (more details), 2.5 Å

PDB Description: Structure of the Skp1-Fbw7-CyclinEdegN complex
PDB Compounds: (A:) S-phase kinase-associated protein 1A

SCOPe Domain Sequences for d2ovra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ovra2 d.42.1.1 (A:1002-1065) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]}
psiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthh

SCOPe Domain Coordinates for d2ovra2:

Click to download the PDB-style file with coordinates for d2ovra2.
(The format of our PDB-style files is described here.)

Timeline for d2ovra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ovra1