Lineage for d2ovpa1 (2ovp A:1085-1159)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1284712Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
    multihelical; interlocked heterodimer with F-box proteins
  4. 1284713Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families) (S)
    automatically mapped to Pfam PF01466
  5. 1284714Family a.157.1.1: Skp1 dimerisation domain-like [81380] (3 proteins)
  6. 1284721Protein Cyclin A/CDK2-associated p45, Skp1 [81378] (1 species)
  7. 1284722Species Human (Homo sapiens) [TaxId:9606] [81376] (8 PDB entries)
  8. 1284737Domain d2ovpa1: 2ovp A:1085-1159 [139382]
    Other proteins in same PDB: d2ovpa2, d2ovpb1, d2ovpb2
    automated match to d1fqvb1

Details for d2ovpa1

PDB Entry: 2ovp (more details), 2.9 Å

PDB Description: Structure of the Skp1-Fbw7 complex
PDB Compounds: (A:) S-phase kinase-associated protein 1A

SCOPe Domain Sequences for d2ovpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ovpa1 a.157.1.1 (A:1085-1159) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]}
ipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfniknd
fteeeeaqvrkenqw

SCOPe Domain Coordinates for d2ovpa1:

Click to download the PDB-style file with coordinates for d2ovpa1.
(The format of our PDB-style files is described here.)

Timeline for d2ovpa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ovpa2