Lineage for d2ovpa1 (2ovp A:1085-1159)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 779401Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
    multihelical; interlocked heterodimer with F-box proteins
  4. 779402Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (1 family) (S)
  5. 779403Family a.157.1.1: Skp1 dimerisation domain-like [81380] (2 proteins)
  6. 779408Protein Cyclin A/CDK2-associated p45, Skp1 [81378] (1 species)
  7. 779409Species Human (Homo sapiens) [TaxId:9606] [81376] (8 PDB entries)
  8. 779424Domain d2ovpa1: 2ovp A:1085-1159 [139382]
    Other proteins in same PDB: d2ovpa2, d2ovpb1, d2ovpb2
    automatically matched to d1fqvb1

Details for d2ovpa1

PDB Entry: 2ovp (more details), 2.9 Å

PDB Description: Structure of the Skp1-Fbw7 complex
PDB Compounds: (A:) S-phase kinase-associated protein 1A

SCOP Domain Sequences for d2ovpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ovpa1 a.157.1.1 (A:1085-1159) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]}
ipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfniknd
fteeeeaqvrkenqw

SCOP Domain Coordinates for d2ovpa1:

Click to download the PDB-style file with coordinates for d2ovpa1.
(The format of our PDB-style files is described here.)

Timeline for d2ovpa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ovpa2