SCOPe 2.08: Domain d2ou8a_: 2ou8 A:

Lineage for d2ou8a_ (2ou8 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.3: Phage lysozyme [53981] (4 proteins)

6. Protein Phage T4 lysozyme [53982] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [53983] (595 PDB entries)
   Uniprot P00720
   many mutant structures

8. Domain d2ou8a_: 2ou8 A: [139375]
   automated match to d2igca1
   complexed with bme, mtn; mutant

Details for d2ou8a_

PDB Entry: 2ou8, 1.8 Å

PDB Description: structure of spin-labeled t4 lysozyme mutant t115r1 at room temperature

PDB Compounds: (A:) lysozyme

SCOPe Domain Sequences for d2ou8a_:

Sequence; same for both SEQRES and ATOM records:

>d2ou8a_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagfcnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl

Timeline for d2ou8a_:

• d2ou8a_ first appeared in SCOP 1.73, called d2ou8a1
  
• d2ou8a_ appears in SCOPe 2.07