Lineage for d2otxb1 (2otx B:14-222)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 805150Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 805151Superfamily b.55.1: PH domain-like [50729] (13 families) (S)
  5. 805152Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (47 proteins)
    Pfam PF00169
  6. 805371Protein Src-associated adaptor protein Skap2 [141417] (1 species)
  7. 805372Species Mouse (Mus musculus) [TaxId:10090] [141418] (4 PDB entries)
    Uniprot Q9Z2K4 105-212! Uniprot Q9Z2K4 109-219! Uniprot Q9Z2K4 14-222
  8. 805381Domain d2otxb1: 2otx B:14-222 [139374]
    automatically matched to 1U5E A:14-222
    mutant

Details for d2otxb1

PDB Entry: 2otx (more details), 2.6 Å

PDB Description: crystal structure of a n-terminal fragment of skap-hom containing both the helical dimerization domain and the ph domain
PDB Compounds: (B:) Src kinase-associated phosphoprotein 2

SCOP Domain Sequences for d2otxb1:

Sequence, based on SEQRES records: (download)

>d2otxb1 b.55.1.1 (B:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]}
peeirnlladvetfvadtlkgenlskkakekreslikkikdvksvylqefqdkgdaedgd
eyddpfagpadtislaserydkdddgpsdgnqfppiaaqdlpfvikagylekrrkdhsfl
gfewqkrwcalsktvfyyygsdkdkqqkgefaidgydvrmnntlrkdgkkdccfeicapd
kriyqftaaspkdaeewvqqlkfilqdlg

Sequence, based on observed residues (ATOM records): (download)

>d2otxb1 b.55.1.1 (B:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]}
peeirnlladvetfvadtlkgenlskkakekreslikkikdvksvylqefqfppiaaqdl
pfvikagylekrrkdhsflgfewqkrwcalsktvfyyygsdkdkqqkgefaidgydvrmn
ntlrkdgkkdccfeicapdkriyqftaaspkdaeewvqqlkfilqdlg

SCOP Domain Coordinates for d2otxb1:

Click to download the PDB-style file with coordinates for d2otxb1.
(The format of our PDB-style files is described here.)

Timeline for d2otxb1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2otxa1