SCOP 1.73: Domain d2otlx1: 2otl X:7-88

Lineage for d2otlx1 (2otl X:7-88)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.29: Ribosomal protein L31e [54574] (1 superfamily)
   beta-alpha-beta-(alpha)-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 1342

4. Superfamily d.29.1: Ribosomal protein L31e [54575] (1 family)

5. Family d.29.1.1: Ribosomal protein L31e [54576] (1 protein)

6. Protein Ribosomal protein L31e [54577] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [54578] (40 PDB entries)

8. Domain d2otlx1: 2otl X:7-88 [139369]
   Other proteins in same PDB: d2otl11, d2otl31, d2otla1, d2otla2, d2otlb1, d2otlc1, d2otld1, d2otle1, d2otle2, d2otlf1, d2otlh1, d2otli1, d2otlj1, d2otlk1, d2otll1, d2otlm1, d2otln1, d2otlo1, d2otlp1, d2otlq1, d2otlr1, d2otls1, d2otlt1, d2otlu1, d2otlv1, d2otlw1, d2otly1, d2otlz1
   automatically matched to d1ffku_
   complexed with 1ma, cd, cl, gir, k, mg, na, omg, omu, psu, ur3

Details for d2otlx1

PDB Entry: 2otl, 2.7 Å

PDB Description: girodazole bound to the large subunit of haloarcula marismortui

PDB Compounds: (X:) 50S ribosomal protein L31e

SCOP Domain Sequences for d2otlx1:

Sequence; same for both SEQRES and ATOM records:

>d2otlx1 d.29.1.1 (X:7-88) Ribosomal protein L31e {Archaeon Haloarcula marismortui [TaxId: 2238]}
ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant
pskirvraarfeeegeaiveae

Timeline for d2otlx1:

• d2otlx1 is new in SCOP 1.73
  
• d2otlx1 appears in SCOP 1.75
  
• d2otlx1 appears in the current release, SCOPe 2.08