![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) ![]() |
![]() | Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein) |
![]() | Protein Ribosomal protein L29 (L29p) [46563] (5 species) |
![]() | Species Haloarcula marismortui [TaxId:2238] [46564] (44 PDB entries) Uniprot P10971 |
![]() | Domain d2otlv1: 2otl V:1-65 [139367] Other proteins in same PDB: d2otl11, d2otl21, d2otl31, d2otla1, d2otla2, d2otlb1, d2otlc1, d2otld1, d2otle1, d2otle2, d2otlf1, d2otlg1, d2otlh1, d2otli1, d2otlj1, d2otlk1, d2otll1, d2otlm1, d2otln1, d2otlo1, d2otlp1, d2otlq1, d2otlr1, d2otls1, d2otlt1, d2otlu1, d2otlw1, d2otlx1, d2otly1, d2otlz1 automatically matched to d1ffks_ complexed with cd, cl, gir, k, mg, na |
PDB Entry: 2otl (more details), 2.7 Å
SCOPe Domain Sequences for d2otlv1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2otlv1 a.2.2.1 (V:1-65) Ribosomal protein L29 (L29p) {Haloarcula marismortui [TaxId: 2238]} tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq geegd
Timeline for d2otlv1:
![]() Domains from other chains: (mouse over for more information) d2otl11, d2otl21, d2otl31, d2otla1, d2otla2, d2otlb1, d2otlc1, d2otld1, d2otle1, d2otle2, d2otlf1, d2otlg1, d2otlh1, d2otli1, d2otlj1, d2otlk1, d2otll1, d2otlm1, d2otln1, d2otlo1, d2otlp1, d2otlq1, d2otlr1, d2otls1, d2otlt1, d2otlu1, d2otlw1, d2otlx1, d2otly1, d2otlz1 |