Lineage for d2otlt1 (2otl T:1-119)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 665027Fold b.34: SH3-like barrel [50036] (18 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 665509Superfamily b.34.5: Translation proteins SH3-like domain [50104] (6 families) (S)
    many known members contain KOW motif
  5. 665510Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)
  6. 665553Protein Ribosomal proteins L24 (L24p) [50106] (2 species)
  7. 665554Species Archaeon Haloarcula marismortui [TaxId:2238] [50107] (44 PDB entries)
  8. 665572Domain d2otlt1: 2otl T:1-119 [139365]
    Other proteins in same PDB: d2otl11, d2otl31, d2otla1, d2otla2, d2otlb1, d2otlc1, d2otld1, d2otle1, d2otle2, d2otlf1, d2otlh1, d2otli1, d2otlj1, d2otlk1, d2otll1, d2otlm1, d2otln1, d2otlo1, d2otlp1, d2otlq1, d2otlr1, d2otls1, d2otlu1, d2otlv1, d2otlw1, d2otlx1, d2otly1, d2otlz1
    automatically matched to d1ffkq_
    complexed with 1ma, cd, cl, gir, k, mg, na, omg, omu, psu, ur3

Details for d2otlt1

PDB Entry: 2otl (more details), 2.7 Å

PDB Description: girodazole bound to the large subunit of haloarcula marismortui
PDB Compounds: (T:) 50S ribosomal protein L24P

SCOP Domain Sequences for d2otlt1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2otlt1 b.34.5.1 (T:1-119) Ribosomal proteins L24 (L24p) {Archaeon Haloarcula marismortui [TaxId: 2238]}
skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg
evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearleseddsa

SCOP Domain Coordinates for d2otlt1:

Click to download the PDB-style file with coordinates for d2otlt1.
(The format of our PDB-style files is described here.)

Timeline for d2otlt1: