Lineage for d2otlq1 (2otl Q:1-95)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 946133Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 946782Superfamily b.34.5: Translation proteins SH3-like domain [50104] (7 families) (S)
    many known members contain KOW motif
  5. 946783Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)
  6. 946784Protein Ribosomal proteins L21e [50108] (1 species)
  7. 946785Species Haloarcula marismortui [TaxId:2238] [50109] (40 PDB entries)
    Uniprot P12734
  8. 946806Domain d2otlq1: 2otl Q:1-95 [139362]
    Other proteins in same PDB: d2otl11, d2otl21, d2otl31, d2otla1, d2otla2, d2otlb1, d2otlc1, d2otld1, d2otle1, d2otle2, d2otlf1, d2otlg1, d2otlh1, d2otli1, d2otlj1, d2otlk1, d2otll1, d2otlm1, d2otln1, d2otlo1, d2otlp1, d2otlr1, d2otls1, d2otlt1, d2otlu1, d2otlv1, d2otlw1, d2otlx1, d2otly1, d2otlz1
    automatically matched to d1ffkn_
    complexed with cd, cl, gir, k, mg, na

Details for d2otlq1

PDB Entry: 2otl (more details), 2.7 Å

PDB Description: girodazole bound to the large subunit of haloarcula marismortui
PDB Compounds: (Q:) 50S ribosomal protein L21e

SCOPe Domain Sequences for d2otlq1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2otlq1 b.34.5.1 (Q:1-95) Ribosomal proteins L21e {Haloarcula marismortui [TaxId: 2238]}
pssngplegtrgklknkprdrgtsppqraveefddgekvhlkidpsvpngrfhprfdgqt
gtvegkqgdaykvdivdggkektiivtaahlrrqe

SCOPe Domain Coordinates for d2otlq1:

Click to download the PDB-style file with coordinates for d2otlq1.
(The format of our PDB-style files is described here.)

Timeline for d2otlq1: